Recombinant Full Length Human APOD Protein, C-Flag-tagged
Cat.No. : | APOD-1603HFL |
Product Overview : | Recombinant Full Length Human APOD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLME NGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQL FHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | APOD apolipoprotein D [ Homo sapiens (human) ] |
Official Symbol | APOD |
Synonyms | apolipoprotein D |
Gene ID | 347 |
mRNA Refseq | NM_001647.4 |
Protein Refseq | NP_001638.1 |
MIM | 107740 |
UniProt ID | P05090 |
◆ Recombinant Proteins | ||
Apod-819M | Recombinant Mouse Apod Protein, MYC/DDK-tagged | +Inquiry |
APOD-1791M | Recombinant Mouse APOD Protein | +Inquiry |
APOD-192H | Recombinant Human APOD Protein, His-tagged | +Inquiry |
APOD-363H | Recombinant Human APOD Protein, His (Fc)-Avi-tagged | +Inquiry |
APOD-1884C | Recombinant Chicken APOD | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOD-8781HCL | Recombinant Human APOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOD Products
Required fields are marked with *
My Review for All APOD Products
Required fields are marked with *
0
Inquiry Basket