Recombinant Human APOD Protein, His-tagged
Cat.No. : | APOD-192H |
Product Overview : | Recombinant Human APOD fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | THis gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. THis glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Molecular Mass : | 20.34kD |
AA Sequence : | QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | APOD apolipoprotein D [ Homo sapiens ] |
Official Symbol | APOD |
Synonyms | APOD; apolipoprotein D; apo-D; |
Gene ID | 347 |
mRNA Refseq | NM_001647 |
Protein Refseq | NP_001638 |
MIM | 107740 |
UniProt ID | P05090 |
◆ Recombinant Proteins | ||
APOD-637M | Recombinant Mouse APOD Protein, His (Fc)-Avi-tagged | +Inquiry |
Apod-819M | Recombinant Mouse Apod Protein, MYC/DDK-tagged | +Inquiry |
APOD-363H | Recombinant Human APOD Protein, His (Fc)-Avi-tagged | +Inquiry |
APOD-3645H | Recombinant Human APOD protein, His-tagged | +Inquiry |
APOD-3653H | Recombinant Human APOD, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOD-8781HCL | Recombinant Human APOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOD Products
Required fields are marked with *
My Review for All APOD Products
Required fields are marked with *
0
Inquiry Basket