Recombinant Human APOH protein, GST-tagged
Cat.No. : | APOH-710H |
Product Overview : | Human APOH full-length ORF ( AAH26283.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 64.7 kDa |
AA Sequence : | MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOH apolipoprotein H (beta-2-glycoprotein I) [ Homo sapiens ] |
Official Symbol | APOH |
Synonyms | APOH; apolipoprotein H (beta-2-glycoprotein I); B2G1; beta-2-glycoprotein 1; beta 2 glycoprotein I; BG; B2GPI; apo-H; beta(2)GPI; APC inhibitor; anticardiolipin cofactor; activated protein C-binding protein; B2GP1; |
Gene ID | 350 |
mRNA Refseq | NM_000042 |
Protein Refseq | NP_000033 |
MIM | 138700 |
UniProt ID | P02749 |
◆ Recombinant Proteins | ||
APOH-393H | Recombinant Human apolipoprotein H (beta-2-glycoprotein I), His-tagged | +Inquiry |
APOH-308H | Recombinant Human APOH protein, His-tagged | +Inquiry |
APOH-640M | Recombinant Mouse APOH Protein, His (Fc)-Avi-tagged | +Inquiry |
APOH-1152HF | Recombinant Full Length Human APOH Protein, GST-tagged | +Inquiry |
APOH-1484C | Recombinant Cynomolgus APOH protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOH-2543HCL | Recombinant Human APOH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOH Products
Required fields are marked with *
My Review for All APOH Products
Required fields are marked with *
0
Inquiry Basket