Recombinant Human AREG protein, GST-tagged
Cat.No. : | AREG-743H |
Product Overview : | Human AREG full-length ORF ( NP_001648.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). The protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells, and it inhibits the growth of certain aggressive carcinoma cell lines. It also functions in mammary gland, oocyte and bone tissue development. This gene is associated with a psoriasis-like skin phenotype, and is also associated with other pathological disorders, including various types of cancers and inflammatory conditions. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 54.3 kDa |
AA Sequence : | MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AREG amphiregulin [ Homo sapiens ] |
Official Symbol | AREG |
Synonyms | AREG; amphiregulin; schwannoma derived growth factor , SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647; |
Gene ID | 374 |
mRNA Refseq | NM_001657 |
Protein Refseq | NP_001648 |
MIM | 104640 |
UniProt ID | P15514 |
◆ Recombinant Proteins | ||
RFL-9669RF | Recombinant Full Length Rat Amphiregulin(Areg) Protein, His-Tagged | +Inquiry |
AREG-1163HF | Recombinant Full Length Human AREG Protein, GST-tagged | +Inquiry |
AREG-515C | Recombinant Cattle AREG protein, His & GST-tagged | +Inquiry |
Areg-517R | Recombinant Rat Areg protein, His & T7-tagged | +Inquiry |
RFL-33712HF | Recombinant Full Length Human Amphiregulin(Areg) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AREG Products
Required fields are marked with *
My Review for All AREG Products
Required fields are marked with *
0
Inquiry Basket