Active Recombinant Human AREG Protein

Cat.No. : AREG-195A
Product Overview : Recombinant Human AREG Protein without tag was expressed in HEK 293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.2 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : 15~20 kDa, observed by reducing SDS-PAGE.
AA Sequence : SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name AREG amphiregulin [ Homo sapiens ]
Official Symbol AREG
Synonyms AREG; amphiregulin; schwannoma derived growth factor, SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647;
Gene ID 374
mRNA Refseq NM_001657
Protein Refseq NP_001648
MIM 104640
UniProt ID P15514

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AREG Products

Required fields are marked with *

My Review for All AREG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon