Active Recombinant Human AREG Protein
Cat.No. : | AREG-195A |
Product Overview : | Recombinant Human AREG Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.2 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | 15~20 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | AREG amphiregulin [ Homo sapiens ] |
Official Symbol | AREG |
Synonyms | AREG; amphiregulin; schwannoma derived growth factor, SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647; |
Gene ID | 374 |
mRNA Refseq | NM_001657 |
Protein Refseq | NP_001648 |
MIM | 104640 |
UniProt ID | P15514 |
◆ Recombinant Proteins | ||
AREG-195A | Active Recombinant Human AREG Protein | +Inquiry |
Areg-517R | Recombinant Rat Areg protein, His & T7-tagged | +Inquiry |
AREG-529H | Recombinant Human AREG protein | +Inquiry |
RFL-33712HF | Recombinant Full Length Human Amphiregulin(Areg) Protein, His-Tagged | +Inquiry |
AREG-1163HF | Recombinant Full Length Human AREG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AREG Products
Required fields are marked with *
My Review for All AREG Products
Required fields are marked with *
0
Inquiry Basket