Active Recombinant Human AREG Protein

Species :	Human
Source :	HEK293
Description :	Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 0.2 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass :	15~20 kDa, observed by reducing SDS-PAGE.
AA Sequence :	SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE.
Storage :	Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	AREG amphiregulin [ Homo sapiens ]
Official Symbol	AREG
Synonyms	AREG; amphiregulin; schwannoma derived growth factor, SDGF; schwannoma-derived growth factor; colorectum cell-derived growth factor; AR; SDGF; AREGB; CRDGF; MGC13647;
Gene ID	374
mRNA Refseq	NM_001657
Protein Refseq	NP_001648
MIM	104640
UniProt ID	P15514