Recombinant Human ARRB1
Cat.No. : | ARRB1-26622TH |
Product Overview : | Recombinant full length Human beta Arrestin 1 with N terminal proprietary tag; Predicted MWt 72.05 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. |
Protein length : | 418 amino acids |
Molecular Weight : | 72.050kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGV VLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLF VANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHK RNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLE ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLAN NREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVS YKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMK DDKEEEEDGTGSPQLNNR |
Sequence Similarities : | Belongs to the arrestin family. |
Gene Name : | ARRB1 arrestin, beta 1 [ Homo sapiens ] |
Official Symbol : | ARRB1 |
Synonyms : | ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2; |
Gene ID : | 408 |
mRNA Refseq : | NM_004041 |
Protein Refseq : | NP_004032 |
MIM : | 107940 |
Uniprot ID : | P49407 |
Chromosome Location : | 11q13 |
Pathway : | CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem; |
Function : | GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding; |
Products Types
◆ Recombinant Protein | ||
ARRB1-458R | Recombinant Rat ARRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Arrb1-430M | Recombinant Mouse Arrb1 Protein, MYC/DDK-tagged | +Inquiry |
ARRB1-753M | Recombinant Mouse ARRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARRB1-26620TH | Recombinant Human ARRB1 | +Inquiry |
ARRB1-0240H | Recombinant Human ARRB1 Protein (Met1-Arg418), C-His-tagged | +Inquiry |
◆ Lysates | ||
ARRB1-8679HCL | Recombinant Human ARRB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket