Recombinant Human ATG12 protein, GST-tagged
Cat.No. : | ATG12-943H |
Product Overview : | Human ATG12 full-length ORF ( AAH11033, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 33.88 kDa |
AA Sequence : | MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG12 ATG12 autophagy related 12 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG12 |
Synonyms | ATG12; ATG12 autophagy related 12 homolog (S. cerevisiae); Apg12 (autophagy 12, S. cerevisiae) like , APG12 autophagy 12 like (S. cerevisiae) , APG12L; ubiquitin-like protein ATG12; APG12; APG12 autophagy 12 like; autophagy-related protein 12; Apg12 (autophagy, yeast) homolog; FBR93; APG12L; HAPG12; |
Gene ID | 9140 |
mRNA Refseq | NM_004707 |
Protein Refseq | NP_004698 |
MIM | 609608 |
UniProt ID | O94817 |
◆ Recombinant Proteins | ||
ATG12-8093Z | Recombinant Zebrafish ATG12 | +Inquiry |
ATG12-820M | Recombinant Mouse ATG12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG12-2074M | Recombinant Mouse ATG12 Protein | +Inquiry |
ATG12-943H | Recombinant Human ATG12 protein, GST-tagged | +Inquiry |
ATG12-1093HF | Recombinant Full Length Human ATG12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG12-8626HCL | Recombinant Human ATG12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG12 Products
Required fields are marked with *
My Review for All ATG12 Products
Required fields are marked with *
0
Inquiry Basket