Recombinant Human ATG4B, His-tagged

• Cat.No.: ATG4B-26192TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-393 of Human ATG4B with N terminal His tag, 58kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-393 a.a.
• Description: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Conjugation: HIS
• Tissue specificity: Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas.
• Form: Lyophilised:Reconstitute with 65 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKD EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRC GQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLA VFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATA FPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGE ELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSI AELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDF EILSL
• Sequence Similarities: Belongs to the peptidase C54 family.
• Full Length: Full L.

Gene Information

• Gene Name: ATG4B ATG4 autophagy related 4 homolog B (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG4B
• Synonyms: ATG4B; ATG4 autophagy related 4 homolog B (S. cerevisiae); APG4 autophagy 4 homolog B (S. cerevisiae) , APG4B; cysteine protease ATG4B; Apg4B; AUTL1; DKFZp586D1822; KIAA0943
• Gene ID: 23192
• mRNA Refseq: NM_013325
• Protein Refseq: NP_037457
• MIM: 611338
• Uniprot ID: Q9Y4P1
• Chromosome Location: 2q37.3
• Pathway: Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem
• Function: cysteine-type peptidase activity; peptidase activity; protein binding