Recombinant Human ATP6AP2 Protein, His-tagged

• Cat.No.: ATP6AP2-02H
• Product Overview: Recombinant human ATP6AP2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 296 amino acids including a 10 a.a N-terminal His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
• Form: Filtered White lyophilized (freeze-dried) powder.
• Molecular Mass: 33 kDa
• AA Sequence: MKHHHHHHASNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFE.
• Purity: > 90% by SDS-PAGE
• Storage: Store lyophilized protein at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade.
• Concentration: 0.5 mg/mL
• Storage Buffer: ATP6AP2 filtered (0.4 μm) and lyophilized in 20 mM Tris buffer and 50 mM NaCl, pH 7.5.
• Dilutions: It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. ATP6AP2 is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
• Shipping: Shipped at Room temperature.

Gene Information

• Gene Name: ATP6AP2 ATPase H+ transporting accessory protein 2 [ Homo sapiens (human) ]
• Official Symbol: ATP6AP2
• Synonyms: ATP6AP2; ATPase H+ transporting accessory protein 2; PRR; M8-9; MRXE; RENR; XMRE; XPDS; CDG2R; HT028; MRXSH; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9; renin receptor; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal accessory protein 2
• Gene ID: 10159
• mRNA Refseq: NM_005765
• Protein Refseq: NP_005756
• MIM: 300556
• UniProt ID: O75787