Recombinant Human ATP6AP2 Protein, His-tagged

Cat.No. : ATP6AP2-02H
Product Overview : Recombinant human ATP6AP2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 296 amino acids including a 10 a.a N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.
Form : Filtered White lyophilized (freeze-dried) powder.
Molecular Mass : 33 kDa
AA Sequence : MKHHHHHHASNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFE.
Purity : > 90% by SDS-PAGE
Storage : Store lyophilized protein at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade.
Concentration : 0.5 mg/mL
Storage Buffer : ATP6AP2 filtered (0.4 μm) and lyophilized in 20 mM Tris buffer and 50 mM NaCl, pH 7.5.
Dilutions : It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. ATP6AP2 is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
Shipping : Shipped at Room temperature.
Gene Name ATP6AP2 ATPase H+ transporting accessory protein 2 [ Homo sapiens (human) ]
Official Symbol ATP6AP2
Synonyms ATP6AP2; ATPase H+ transporting accessory protein 2; PRR; M8-9; MRXE; RENR; XMRE; XPDS; CDG2R; HT028; MRXSH; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9; renin receptor; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal accessory protein 2
Gene ID 10159
mRNA Refseq NM_005765
Protein Refseq NP_005756
MIM 300556
UniProt ID O75787

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP6AP2 Products

Required fields are marked with *

My Review for All ATP6AP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon