Recombinant Human BCL2L11 Protein, GST-tagged
Cat.No. : | BCL2L11-150H |
Product Overview : | Human BCL2L11 full-length ORF ( ENSP00000309226, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family, including BCL2, BCL2L1/BCL-X(L), and MCL1, and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.7 kDa |
AA Sequence : | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ] |
Official Symbol | BCL2L11 |
Synonyms | BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6; |
Gene ID | 10018 |
mRNA Refseq | NM_001204106 |
Protein Refseq | NP_001191035 |
MIM | 603827 |
UniProt ID | O43521 |
◆ Recombinant Proteins | ||
BCL2L11-3454H | Recombinant Human BCL2L11 protein, His-tagged | +Inquiry |
BCL2L11-133H | Recombinant Human BCL2L11 protein(Ala2-Arg120), His-tagged | +Inquiry |
BCL2L11-1525H | Recombinant Human BCL2L11 protein, His-tagged | +Inquiry |
BCL2L11-960R | Recombinant Rat BCL2L11 Protein | +Inquiry |
BCL2L11-1629HF | Recombinant Full Length Human BCL2L11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L11-60HCL | Recombinant Human BCL2L11 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L11 Products
Required fields are marked with *
My Review for All BCL2L11 Products
Required fields are marked with *
0
Inquiry Basket