Recombinant Human BCL2L11 protein, His-tagged
| Cat.No. : | BCL2L11-3454H |
| Product Overview : | Recombinant Human BCL2L11 protein(O43521)(1-198aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-198a.a. |
| Tag : | His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH |
| Gene Name | BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ] |
| Official Symbol | BCL2L11 |
| Synonyms | BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6; |
| Gene ID | 10018 |
| mRNA Refseq | NM_001204106 |
| Protein Refseq | NP_001191035 |
| MIM | 603827 |
| UniProt ID | O43521 |
| ◆ Recombinant Proteins | ||
| BCL2L11-1525H | Recombinant Human BCL2L11 protein, His-tagged | +Inquiry |
| BCL2L11-7198Z | Recombinant Zebrafish BCL2L11 | +Inquiry |
| BCL2L11-3454H | Recombinant Human BCL2L11 protein, His-tagged | +Inquiry |
| BCL2L11-960R | Recombinant Rat BCL2L11 Protein | +Inquiry |
| BCL2L11-572H | Active Recombinant Human BCL2L11 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2L11-60HCL | Recombinant Human BCL2L11 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L11 Products
Required fields are marked with *
My Review for All BCL2L11 Products
Required fields are marked with *
