Recombinant Human BMP4 Protein

Cat.No. : BMP4-402H
Product Overview : Recombinant Human BMP4 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Bone Morphogenetic Protein 4 is one of the BMPs, some of which belong to the TGF-beta superfamily (BMP2-7). There are more than thirteen BMPs have been discovered nowadays and they are involved in inducing cartilage and bone formation. BMP-4 is expressed in the lung and lower levels seen in the kidney. It also presents in normal and neoplastic prostate tissues, and prostate cancer cell lines. It regulates the formation of teeth, limbs and bone from mesoderm. Furthermore it also plays a role in fracture repair. BMP-4 signals through tetrameric complexes composed of type I and type II receptors and regulates it function by interaction with multiple proteins and glycosaminoglycans. The human BMP-4 shares 98 % sequence indentity with mouse BMP-4. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva.
Form : Sterile Filtered White lyophil
Molecular Mass : Approximately 13.3 kDa
AA Sequence : MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Endotoxin : Less than 1 EU/μg of rHuBMP-4 as determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in 50 mM Na2CO3, 5 mM DTT, pH 11.0.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1-1.0 mg/mL.
Gene Name BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ]
Official Symbol BMP4
Synonyms BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6;
Gene ID 652
mRNA Refseq NM_001202
Protein Refseq NP_001193
MIM 112262
UniProt ID P12644

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP4 Products

Required fields are marked with *

My Review for All BMP4 Products

Required fields are marked with *

0
cart-icon