Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Description : |
Bone Morphogenetic Protein 4 is one of the BMPs, some of which belong to the TGF-beta superfamily (BMP2-7). There are more than thirteen BMPs have been discovered nowadays and they are involved in inducing cartilage and bone formation. BMP-4 is expressed in the lung and lower levels seen in the kidney. It also presents in normal and neoplastic prostate tissues, and prostate cancer cell lines. It regulates the formation of teeth, limbs and bone from mesoderm. Furthermore it also plays a role in fracture repair. BMP-4 signals through tetrameric complexes composed of type I and type II receptors and regulates it function by interaction with multiple proteins and glycosaminoglycans. The human BMP-4 shares 98 % sequence indentity with mouse BMP-4. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. |
Form : |
Sterile Filtered White lyophil |
Molecular Mass : |
Approximately 13.3 kDa |
AA Sequence : |
MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : |
Less than 1 EU/μg of rHuBMP-4 as determined by LAL method. |
Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered concentrated solution in 50 mM Na2CO3, 5 mM DTT, pH 11.0. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1-1.0 mg/mL. |