Active Recombinant Mouse BMP4 Protein, His-MBP-tagged
Cat.No. : | BMP4-267H |
Product Overview : | Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 303-408 a.a. |
Form : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml. |
AA Sequence : | KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
Purity : | 98% |
Storage : | Store at -20 centigrade.Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Gene Name | Bmp4 bone morphogenetic protein 4 [ Mus musculus ] |
Official Symbol | Bmp4 |
Synonyms | BMP4; bone morphogenetic protein 4; BMP-2B; bone morphogenetic protein 2B; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1; |
Gene ID | 12159 |
mRNA Refseq | NM_007554 |
Protein Refseq | NP_031580 |
◆ Recombinant Proteins | ||
BMP4-532B | Recombinant Bovine BMP4 protein, RbFc-tagged | +Inquiry |
BMP4-02P | Recombinant Pig BMP4 Protein (Arg227-Cys408), C-His tagged, Animal-free, Carrier-free | +Inquiry |
bmp4-809Z | Active Recombinant Zebrafish bmp4 | +Inquiry |
BMP4-321H | Recombinant Human BMP4 Protein, His-tagged | +Inquiry |
BMP4-1169B | Recombinant Bovine BMP4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket