Active Recombinant Mouse BMP4 Protein, His-MBP-tagged

Cat.No. : BMP4-267H
Product Overview : Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 303-408 a.a.
Form : Lyophilized from solutions contain no sodiun azide nor carrier protein
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
AA Sequence : KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Endotoxin : Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
Purity : 98%
Storage : Store at -20 centigrade.Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name Bmp4 bone morphogenetic protein 4 [ Mus musculus ]
Official Symbol Bmp4
Synonyms BMP4; bone morphogenetic protein 4; BMP-2B; bone morphogenetic protein 2B; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1;
Gene ID 12159
mRNA Refseq NM_007554
Protein Refseq NP_031580

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP4 Products

Required fields are marked with *

My Review for All BMP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon