Active Recombinant Mouse BMP4 Protein, His-MBP-tagged

• Cat.No.: BMP4-267H
• Product Overview: Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 303-408 a.a.
• Form: Lyophilized from solutions contain no sodiun azide nor carrier protein
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
• AA Sequence: KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
• Purity: 98%
• Storage: Store at -20 centigrade.Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: Bmp4 bone morphogenetic protein 4 [ Mus musculus ]
• Official Symbol: Bmp4
• Synonyms: BMP4; bone morphogenetic protein 4; BMP-2B; bone morphogenetic protein 2B; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1
• Gene ID: 12159
• mRNA Refseq: NM_007554
• Protein Refseq: NP_031580