Active Recombinant Mouse BMP4 Protein, His-MBP-tagged
| Cat.No. : | BMP4-267H |
| Product Overview : | Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 303-408 a.a. |
| Form : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Bio-activity : | Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml. |
| AA Sequence : | KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Endotoxin : | Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug). |
| Purity : | 98% |
| Storage : | Store at -20 centigrade.Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Gene Name | Bmp4 bone morphogenetic protein 4 [ Mus musculus ] |
| Official Symbol | Bmp4 |
| Synonyms | BMP4; bone morphogenetic protein 4; BMP-2B; bone morphogenetic protein 2B; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1; |
| Gene ID | 12159 |
| mRNA Refseq | NM_007554 |
| Protein Refseq | NP_031580 |
| ◆ Recombinant Proteins | ||
| Bmp4-214M | Recombinant Mouse Bmp4 protein, His/S-tagged | +Inquiry |
| BMP4-321H | Active Recombinant Human BMP4 protein, His-tagged | +Inquiry |
| BMP4-1054M | Recombinant Mouse BMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMP4-1132B | Active Recombinant Bovine BMP4 protein, His-tagged | +Inquiry |
| Bmp4-573R | Active Recombinant Rat Bmp4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
| BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
