Recombinant Human BRAP Protein (1-592 aa), His-tagged
Cat.No. : | BRAP-1687H |
Product Overview : | Recombinant Human BRAP Protein (1-592 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-592 aa |
Description : | Negatively regulates MAP kinase activation by limiting the formation of Raf/MEK complexes probably by inactivation of the KSR1 scaffold protein. Also acts as a Ras responsive E3 ubiquitin ligase that, on activation of Ras, is modified by auto-polyubiquitination resulting in the release of inhibition of Raf/MEK complex formation. May also act as a Cytoplasmic domain retention protein with a role in regulating nuclear transport. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 69.3 kDa |
AA Sequence : | MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | BRAP BRCA1 associated protein [ Homo sapiens ] |
Official Symbol | BRAP |
Synonyms | BRAP; BRAP2; IMP; RNF52; RING finger protein 52; |
Gene ID | 8315 |
mRNA Refseq | NM_006768 |
Protein Refseq | NP_006759 |
MIM | 604986 |
UniProt ID | Q7Z569 |
◆ Recombinant Proteins | ||
BRAP-3593C | Recombinant Chicken BRAP | +Inquiry |
BRAP-2478M | Recombinant Mouse BRAP Protein | +Inquiry |
BRAP-4242H | Recombinant Human BRAP protein, His-tagged | +Inquiry |
BRAP-389R | Recombinant Rhesus Macaque BRAP Protein, His (Fc)-Avi-tagged | +Inquiry |
BRAP-637H | Recombinant Human BRAP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRAP-8413HCL | Recombinant Human BRAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRAP Products
Required fields are marked with *
My Review for All BRAP Products
Required fields are marked with *
0
Inquiry Basket