Recombinant Human BRAP protein, GST-tagged
Cat.No. : | BRAP-7854H |
Product Overview : | Recombinant Human BRAP protein(100-200 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 100-200 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | AQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPN |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BRAP BRCA1 associated protein [ Homo sapiens ] |
Official Symbol | BRAP |
Synonyms | BRAP; BRCA1 associated protein; BRCA1-associated protein; BRAP2; galectin 2 binding protein; IMP; impedes mitogenic signal propagation; RNF52; RING finger protein 52; galectin-2-binding protein; renal carcinoma antigen NY-REN-63; |
mRNA Refseq | NM_006768 |
Protein Refseq | NP_006759 |
MIM | 604986 |
UniProt ID | Q7Z569 |
Gene ID | 8315 |
◆ Recombinant Proteins | ||
BRAP-7854H | Recombinant Human BRAP protein, GST-tagged | +Inquiry |
BRAP-3593C | Recombinant Chicken BRAP | +Inquiry |
BRAP-637H | Recombinant Human BRAP Protein, His-tagged | +Inquiry |
BRAP-389R | Recombinant Rhesus Macaque BRAP Protein, His (Fc)-Avi-tagged | +Inquiry |
BRAP-596Z | Recombinant Zebrafish BRAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRAP-8413HCL | Recombinant Human BRAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRAP Products
Required fields are marked with *
My Review for All BRAP Products
Required fields are marked with *