Recombinant Human BRCA1 Protein, GST-tagged

Cat.No. : BRCA1-325H
Product Overview : Human BRCA1 full-length ORF ( NP_009237.1, 1 a.a. - 59 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33.1 kDa
AA Sequence : MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKVLLCCPSWSTVVRS
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRCA1 breast cancer 1, early onset [ Homo sapiens ]
Official Symbol BRCA1
Synonyms BRCA1; breast cancer 1, early onset; breast cancer type 1 susceptibility protein; BRCA1/BRCA2 containing complex; subunit 1; BRCC1; PPP1R53; protein phosphatase 1; regulatory subunit 53; RNF53; RING finger protein 53; BRCA1/BRCA2-containing complex, subunit 1; protein phosphatase 1, regulatory subunit 53; breast and ovarian cancer susceptibility protein 1; breast and ovarian cancer sususceptibility protein 1; IRIS; PSCP; BRCAI; PNCA4; BROVCA1;
Gene ID 672
mRNA Refseq NM_007294
Protein Refseq NP_009225
MIM 113705
UniProt ID P38398

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRCA1 Products

Required fields are marked with *

My Review for All BRCA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon