Recombinant Human BTC Protein, GST-tagged

Cat.No. : BTC-377H
Product Overview : Human BTC full-length ORF ( AAH11618, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.21 kDa
AA Sequence : MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICMIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BTC betacellulin [ Homo sapiens ]
Official Symbol BTC
Synonyms BTC; betacellulin; probetacellulin;
Gene ID 685
mRNA Refseq NM_001729
Protein Refseq NP_001720
MIM 600345
UniProt ID P35070

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTC Products

Required fields are marked with *

My Review for All BTC Products

Required fields are marked with *

0
cart-icon