Recombinant Human C4A Protein (957-1336), N-T7-His-TEV tagged
Cat.No. : | C4A-31H |
Product Overview : | Full-length human C4d domain cDNA (957-1336 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29 aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique "temperature shift inclusion body refolding" technology and chromatographically purified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 957-1336 |
Description : | Human C4 ( Total 1744aa ) gene encodes the acidic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor, which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus and type I diabetes mellitus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. Recent data indicated that one of the C4 proteolytical fragment C4d (957-1336aa fragment) was linked to higher mortality rates in lung cancer patients, which may be developed as biomarker in monitoring cancer treatment. |
Form : | Liquid |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR |
Purity : | > 90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used for protein-protein interaction assay. 3. As potential diagnostic biomarker for rumors, such as lung cancer. 4. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Concentration : | 1.0 mg/mL |
Storage Buffer : | Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT. |
Gene Name | C4A complement C4A (Rodgers blood group) [ Homo sapiens (human) ] |
Official Symbol | C4A |
Synonyms | C4A; complement C4A (Rodgers blood group); C4; RG; C4S; CO4; C4A2; C4A3; C4A4; C4A6; C4AD; CPAMD2; complement C4-A; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C4A anaphylatoxin; MHC class III region complement; Rodgers form of C4; acidic C4; acidic complement C4; complement component 4A (Rodgers blood group) |
Gene ID | 720 |
mRNA Refseq | NM_007293 |
Protein Refseq | NP_009224 |
MIM | 120810 |
UniProt ID | P0C0L4 |
◆ Recombinant Proteins | ||
C4A-566H | Recombinant Human C4A Protein, His/GST-tagged | +Inquiry |
C4a-339R | Recombinant Rat C4a Protein, His-tagged | +Inquiry |
C4A-0346H | Recombinant Human C4A Protein (Thr1021-Thr1330), N-His-tagged | +Inquiry |
C4A-0345H | Recombinant Human C4A Protein (Asn680-Arg756), N-His-tagged | +Inquiry |
C4A-31H | Recombinant Human C4A Protein (957-1336), N-T7-His-TEV tagged | +Inquiry |
◆ Native Proteins | ||
C4A-8392H | Native Human C4A | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *
0
Inquiry Basket