Recombinant Human C4A Protein, GST-Tagged
Cat.No. : | C4A-0050H |
Product Overview : | Human C4A partial ORF (AAH63289, 61 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the acidic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus and type I diabetes mellitus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C4A complement component 4A (Rodgers blood group) [ Homo sapiens ] |
Official Symbol | C4A |
Synonyms | C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C4AD; MGC164979; |
Gene ID | 720 |
mRNA Refseq | NM_001252204 |
Protein Refseq | NP_001239133 |
MIM | 120810 |
UniProt ID | P0C0L4 |
◆ Recombinant Proteins | ||
C4A-710R | Recombinant Rat C4A Protein, His (Fc)-Avi-tagged | +Inquiry |
C4A-3784H | Recombinant Human C4A protein, His-tagged | +Inquiry |
C4a-339R | Recombinant Rat C4a Protein, His-tagged | +Inquiry |
C4A-1052R | Recombinant Rat C4A Protein | +Inquiry |
C4A-187H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
◆ Native Proteins | ||
C4A-158H | Native Human C4A protein | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *
0
Inquiry Basket