Recombinant Human C4A protein, T7/His-tagged
Cat.No. : | C4A-188H |
Product Overview : | Recombinant human C4 gamma domain cDNA ( 1454 – 1744 aa ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 1454-1744 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRA DLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPS KSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQ VLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQR AACAQLNDFLQEYGTQGCQV |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human complement C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study by using this protein as coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. Potential Diagnostic biomarker protein for tumors, such as lung cancer.4. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | C4A complement component 4A (Rodgers blood group) [ Homo sapiens ] |
Official Symbol | C4A |
Synonyms | C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2; C4AD; MGC164979; |
Gene ID | 720 |
mRNA Refseq | NM_001252204 |
Protein Refseq | NP_001239133 |
MIM | 120810 |
UniProt ID | P0C0L4 |
Chromosome Location | 6p21.3 |
Pathway | Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem; |
Function | endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
C4A-3784H | Recombinant Human C4A protein, His-tagged | +Inquiry |
C4A-98H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
C4A-710R | Recombinant Rat C4A Protein, His (Fc)-Avi-tagged | +Inquiry |
C4A-187H | Recombinant Human C4A protein, T7/His-tagged | +Inquiry |
C4A-31H | Recombinant Human C4A Protein (957-1336), N-T7-His-TEV tagged | +Inquiry |
◆ Native Proteins | ||
C4A-2H | Native Human Complement C4 | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *