Recombinant Human CA9
Cat.No. : | CA9-27269TH |
Product Overview : | Recombinant full length, Human Carbonic Anhydrase IX (amino acids 1-459) with N terminal proprietary tag, 76.56kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 459 amino acids |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide.They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid.They show extensive diversity in tissue distribution and in their subcellular localization.CA IX is a transmembrane protein and the only tumor-associated carbonic anhydrase isoenzyme known.It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues.It may be involved in cell proliferation and transformation.This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12. |
Molecular Weight : | 76.560kDa inclusive of tags |
Tissue specificity : | Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLMPVHPQRL PRMQEDSPLGGGSSGEDDPLGEEDLPSEEDSPREEDPPGE EDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRF QSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGH SVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSD FSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRA AEPVQLNSCLAAGDILALVFGLLFAVTSVAFLVQMRRQHR RGTKGGVSYRPAEVAETGA |
Sequence Similarities : | Belongs to the alpha-carbonic anhydrase family. |
Gene Name | CA9 carbonic anhydrase IX [ Homo sapiens ] |
Official Symbol | CA9 |
Synonyms | CA9; carbonic anhydrase IX; carbonic anhydrase 9; CAIX; carbonic dehydratase; MN; RCC associated protein G250; |
Gene ID | 768 |
mRNA Refseq | NM_001216 |
Protein Refseq | NP_001207 |
MIM | 603179 |
Uniprot ID | Q16790 |
Chromosome Location | 9p12 |
Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem; |
Function | carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
CA9-256HF | Recombinant Human CA9 Protein, His-tagged, FITC conjugated | +Inquiry |
CA9-10627H | Recombinant Human CA9 protein, GST-tagged | +Inquiry |
CA9-48HF | Recombinant Full Length Human CA9 Protein | +Inquiry |
CA9-890H | Active Recombinant Human CA9 protein, hFc-tagged | +Inquiry |
CA9-256H | Recombinant Human CA9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA9-3065HCL | Recombinant Human CA9 cell lysate | +Inquiry |
CA9-1447CCL | Recombinant Canine CA9 cell lysate | +Inquiry |
CA9-2189MCL | Recombinant Mouse CA9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA9 Products
Required fields are marked with *
My Review for All CA9 Products
Required fields are marked with *
0
Inquiry Basket