Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Human CA9

Cat.No. : CA9-27269TH
Product Overview : Recombinant full length, Human Carbonic Anhydrase IX (amino acids 1-459) with N terminal proprietary tag, 76.56kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide.They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid.They show extensive diversity in tissue distribution and in their subcellular localization.CA IX is a transmembrane protein and the only tumor-associated carbonic anhydrase isoenzyme known.It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues.It may be involved in cell proliferation and transformation.This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.
Protein length : 459 amino acids
Molecular Weight : 76.560kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLMPVHPQRL PRMQEDSPLGGGSSGEDDPLGEEDLPSEEDSPREEDPPGE EDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRF QSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGH SVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSD FSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRA AEPVQLNSCLAAGDILALVFGLLFAVTSVAFLVQMRRQHR RGTKGGVSYRPAEVAETGA
Sequence Similarities : Belongs to the alpha-carbonic anhydrase family.
Tag : Non
Gene Name : CA9 carbonic anhydrase IX [ Homo sapiens ]
Official Symbol : CA9
Synonyms : CA9; carbonic anhydrase IX; carbonic anhydrase 9; CAIX; carbonic dehydratase; MN; RCC associated protein G250;
Gene ID : 768
mRNA Refseq : NM_001216
Protein Refseq : NP_001207
MIM : 603179
Uniprot ID : Q16790
Chromosome Location : 9p12
Pathway : HIF-1-alpha transcription factor network, organism-specific biosystem; Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem;
Function : carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
08/04/2022

    Exceptional consistency, vital for our research's reliability.

    12/16/2021

      Critical support for our protein analysis and quantification.

      02/07/2021

        Unmatched accuracy in protein identification and sequencing.

        Q&As (7)

        Ask a question
        What signaling pathways are known to regulate CA9 expression? 06/15/2022

        The HIF-1 signaling pathway primarily regulates CA9 in response to cellular oxygen levels.

        How does CA9 contribute to pH regulation within the tumor microenvironment? 02/02/2022

        CA9 aids in extracellular acidification, promoting tumor cell survival and invasion in acidic tumor microenvironments.

        How is CA9 expression regulated in hypoxic conditions? 04/15/2021

        CA9 expression is upregulated by the hypoxia-inducible factor (HIF) under low oxygen conditions.

        How are elevated levels of CA9 associated with cancer prognosis? 05/26/2020

        Elevated CA9 levels often correlate with poor prognosis in various cancers due to its role in tumor adaptation to hypoxia.

        What post-translational modifications have been identified on CA9? 11/23/2017

        Potential modifications like glycosylation can be identified using techniques like mass spectrometry.

        Are there specific inhibitors that target CA9, especially in cancer therapeutics? 09/29/2017

        Several inhibitors, like acetazolamide derivatives, have been explored to target CA9 in cancer treatment.

        What roles does CA9 play in tumor physiology? 07/06/2017

        CA9 helps tumors survive in hypoxic conditions by regulating pH through the conversion of CO2 to bicarbonate and protons.

        Ask a Question for All CA9 Products

        Required fields are marked with *

        My Review for All CA9 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends