Recombinant Human CALCA protein, GST-tagged

• Cat.No.: CALCA-301179H
• Product Overview: Recombinant Human CALCA (85-116 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Cys85-Pro116
• AA Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CALCA calcitonin-related polypeptide alpha [ Homo sapiens ]
• Official Symbol: CALCA
• Synonyms: CALCA; calcitonin-related polypeptide alpha; CALC1, calcitonin 1; calcitonin; calcitonin gene-related peptide 1; calcitonin; katacalcin; calcitonin 1; alpha-type CGRP; calcitonin gene-related peptide I; calcitonin/calcitonin-related polypeptide, alpha; CT; KC; CGRP; CALC1; CGRP1; CGRP-I; MGC126648
• Gene ID: 796
• mRNA Refseq: NM_001033952
• Protein Refseq: NP_001029124
• MIM: 114130
• UniProt ID: P01258