Recombinant Human CALCA protein, GST-tagged
Cat.No. : | CALCA-301179H |
Product Overview : | Recombinant Human CALCA (85-116 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Cys85-Pro116 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CALCA calcitonin-related polypeptide alpha [ Homo sapiens ] |
Official Symbol | CALCA |
Synonyms | CALCA; calcitonin-related polypeptide alpha; CALC1, calcitonin 1; calcitonin; calcitonin gene-related peptide 1; calcitonin; katacalcin; calcitonin 1; alpha-type CGRP; calcitonin gene-related peptide I; calcitonin/calcitonin-related polypeptide, alpha; CT; KC; CGRP; CALC1; CGRP1; CGRP-I; MGC126648; |
Gene ID | 796 |
mRNA Refseq | NM_001033952 |
Protein Refseq | NP_001029124 |
MIM | 114130 |
UniProt ID | P01258 |
◆ Recombinant Proteins | ||
Calca-862R | Recombinant Rat Calca Protein, His&SUMO-tagged | +Inquiry |
CALCA-2620D | Recombinant Dog CALCA protein, His-SUMO-tagged | +Inquiry |
CALCA-1255H | Recombinant Human CALCA protein, His-tagged | +Inquiry |
CALCA-150H | Recombinant Human CALCA protein, GST-tagged | +Inquiry |
CALCA-10658H | Recombinant Human CALCA, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCA-7895HCL | Recombinant Human CALCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALCA Products
Required fields are marked with *
My Review for All CALCA Products
Required fields are marked with *
0
Inquiry Basket