Recombinant Human CALCA protein, His-tagged
Cat.No. : | CALCA-6734H |
Product Overview : | Recombinant Human CALCA protein(85-116 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | His |
Protein Length : | 85-116 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP |
Gene Name | CALCA calcitonin-related polypeptide alpha [ Homo sapiens ] |
Official Symbol | CALCA |
Synonyms | CALCA; calcitonin-related polypeptide alpha; CALC1, calcitonin 1; calcitonin; calcitonin gene-related peptide 1; calcitonin; katacalcin; calcitonin 1; alpha-type CGRP; calcitonin gene-related peptide I; calcitonin/calcitonin-related polypeptide, alpha; CT; KC; CGRP; CALC1; CGRP1; CGRP-I; MGC126648; |
Gene ID | 796 |
mRNA Refseq | NM_001033952 |
Protein Refseq | NP_001029124 |
MIM | 114130 |
UniProt ID | P01258 |
◆ Recombinant Proteins | ||
Calca-862R | Recombinant Rat Calca Protein, His&SUMO-tagged | +Inquiry |
CALCA-794C | Recombinant Chicken CALCA protein, His-tagged | +Inquiry |
CALCA-3047HF | Recombinant Full Length Human CALCA Protein, GST-tagged | +Inquiry |
CALCA-6744H | Recombinant Human CALCA protein, His-sumostar-tagged | +Inquiry |
CALCA-751R | Recombinant Rat CALCA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCA-7895HCL | Recombinant Human CALCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCA Products
Required fields are marked with *
My Review for All CALCA Products
Required fields are marked with *