Active Recombinant Human CCL20 Protein (70 aa)
Cat.No. : | CCL20-218C |
Product Overview : | Recombinant humanMIP-3 alpha/CCL20 produced in CHO cells is a polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-3 alpha/CCL20 has a molecular mass of 8kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Protein Length : | 70 |
Description : | Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of humanMIP-3 alpha/CCL20 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/mL. |
Molecular Mass : | 8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human MIP-3 alpha/CCL20 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human MIP-3 alpha/CCL20 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ] |
Official Symbol | CCL20 |
Synonyms | CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20; |
Gene ID | 6364 |
mRNA Refseq | NM_001130046 |
Protein Refseq | NP_001123518 |
MIM | 601960 |
UniProt ID | P78556 |
◆ Recombinant Proteins | ||
CCL20-17H | Recombinant Human CCL20 Protein | +Inquiry |
CCL20-512R | Recombinant Rhesus Macaque CCL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL20-684R | Recombinant Rhesus monkey CCL20 Protein, His-tagged | +Inquiry |
CCL20-2651H | Recombinant Human CCL20 protein, GST-tagged | +Inquiry |
CCL20-2652R | Recombinant Rhesus macaque CCL20 protein, His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
0
Inquiry Basket