Recombinant Human CCL20 protein, GST-tagged
Cat.No. : | CCL20-2651H |
Product Overview : | Recombinant Human CCL20 protein(P78556)(27-95aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 27-95aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.9 kDa |
AA Sequence : | ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ] |
Official Symbol | CCL20 |
Synonyms | CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20; |
Gene ID | 6364 |
mRNA Refseq | NM_001130046 |
Protein Refseq | NP_001123518 |
MIM | 601960 |
UniProt ID | P78556 |
◆ Recombinant Proteins | ||
CCL20-870R | Recombinant Rat CCL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL20-15M | Recombinant Macaca mulatta CCL20 protein, GST-tagged | +Inquiry |
CCL20-151H | Recombinant Human CCL20 Protein, His-tagged | +Inquiry |
CCL20-793M | Recombinant Mouse CCL20 Protein (Ala28-Met97) | +Inquiry |
CCL20-4364R | Recombinant Rabbit CCL20 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
0
Inquiry Basket