"CCL24" Related Products

Expand
Expand
Expand

Recombinant Human CCL24 Protein, GST-Tagged

Cat.No. : CCL24-0629H
Product Overview : Human CCL24 full-length ORF (NP_002982.2, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 39.5 kDa
AA Sequence : MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CCL24 chemokine (C-C motif) ligand 24 [ Homo sapiens ]
Official Symbol : CCL24
Synonyms : CCL24; chemokine (C-C motif) ligand 24; SCYA24, small inducible cytokine subfamily A (Cys Cys), member 24; C-C motif chemokine 24; CK beta 6; Ckb 6; eotaxin 2; MPIF 2; MPIF2; myeloid progenitor inhibitory factor 2; CK-beta-6; eotaxin-2; small-inducible cytokine A24; eosinophil chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 24; Ckb-6; MPIF-2; SCYA24;
Gene ID : 6369
mRNA Refseq : NM_002991
Protein Refseq : NP_002982
MIM : 602495
UniProt ID : O00175

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.