Recombinant Human CCL26 Protein
Cat.No. : | CCL26-21H |
Product Overview : | Recombinant Human CCL26 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Eotaxin-3, also known as CCL26, MIP-4-alpha, and TSC-1, is a chemokine that is made by vascular endothelial and lung epithelial cells following interleukin 4 (IL-4) or interleukin 13 (IL-13) stimulation. Eotaxin-3 signals through the G protein-coupled chemokine receptor CCR3 to recruit eosinophils and basophils to inflammatory sites. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8.4 kDa (71 aa) |
AA Sequence : | TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
Endotoxin : | 1 EUs/μg, Kinetic LAL |
Purity : | 0.95, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL26 chemokine (C-C motif) ligand 26 [ Homo sapiens (human) ] |
Official Symbol | CCL26 |
Synonyms | CCL26; chemokine (C-C motif) ligand 26; SCYA26, small inducible cytokine subfamily A (Cys Cys), member 26; C-C motif chemokine 26; CC chemokine IMAC; chemokine N1; eotaxin 3; IMAC; macrophage inflammatory protein 4 alpha; MIP 4a; MIP 4alpha; small inducible cytokine A26; thymic stroma chemokine 1; TSC 1; eotaxin-3; MIP-4-alpha; thymic stroma chemokine-1; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26; TSC-1; MIP-4a; SCYA26; MIP-4alpha; MGC126714; |
Gene ID | 10344 |
mRNA Refseq | NM_006072 |
Protein Refseq | NP_006063 |
MIM | 604697 |
UniProt ID | Q9Y258 |
◆ Recombinant Proteins | ||
CCL26-151H | Recombinant Human CCL26 Protein, His-tagged | +Inquiry |
CCL26-26912TH | Recombinant Human CCL26 | +Inquiry |
CCL26-21H | Recombinant Human CCL26 Protein | +Inquiry |
CCL26-2946HF | Recombinant Full Length Human CCL26 Protein, GST-tagged | +Inquiry |
CCL26-127C | Active Recombinant Human CCL26 Protein (71 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL26-7725HCL | Recombinant Human CCL26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL26 Products
Required fields are marked with *
My Review for All CCL26 Products
Required fields are marked with *