Recombinant Human CCL3 Protein
Cat.No. : | CCL3-22H |
Product Overview : | Recombinant Human CCL3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Macrophage inflammatory protein-1 alpha (MIP-1 α), also known as CCL3, is a cytokine produced by macrophages. MIP-1 α binds the chemokine receptors CCR1, CCR4 and CCR5 to induce inflammatory responses, including the recruitment of granulocytes and neutrophil superoxide production. The MIP-1 α and MIP-1 β heterodimer exhibits antiviral activity against the human immunodeficiency virus 1 (HIV-1). |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 7.8 kDa (70 aa) |
AA Sequence : | ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens (human) ] |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha; |
Gene ID | 6348 |
mRNA Refseq | NM_002983 |
Protein Refseq | NP_002974 |
MIM | 182283 |
UniProt ID | P10147 |
◆ Recombinant Proteins | ||
CCL3-70H | Recombinant Human CCL3 Protein | +Inquiry |
CCL3-1491H | Recombinant Human CCL3 Protein (Ser24-Ala92), N-His tagged | +Inquiry |
CCL3-1490H | Recombinant Human CCL3 Protein (Ala27-Ala92), N-GST tagged | +Inquiry |
CCL3-021H | Recombinant Human CCL3 Protein, Biotinylated | +Inquiry |
CCL3-78H | Recombinant Human CCL3 Protein, Biotin-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *