Recombinant Human CCL3 Protein, Biotinylated
Cat.No. : | CCL3-021H |
Product Overview : | Biotinylated Recombinant human CCL3 protein was tag free expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 92 |
Description : | This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1. |
Form : | Lyophilized |
AA Sequence : | MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
Purity : | > 97% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Conjugation : | Biotin |
Gene Name | CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens (human) ] |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha; |
Gene ID | 6348 |
mRNA Refseq | NM_002983 |
Protein Refseq | NP_002974 |
MIM | 182283 |
UniProt ID | P10147 |
◆ Recombinant Proteins | ||
CCL3-276H | Recombinant Human CCL3, StrepII-tagged | +Inquiry |
CCL3-020H | Recombinant Human CCL3 Protein | +Inquiry |
Ccl3-8705M | Recombinant Mouse Ccl3 protein(Ala24-Ala92) | +Inquiry |
Ccl3-7337M | Recombinant Mouse Ccl3 Protein, His-tagged | +Inquiry |
CCL3-169H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *