Recombinant Human CCS protein, His-tagged
Cat.No. : | CCS-314H |
Product Overview : | Recombinant Human CCS protein(NP_005116)(1-274 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-274 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CCS copper chaperone for superoxide dismutase [ Homo sapiens ] |
Official Symbol | CCS |
Synonyms | CCS; copper chaperone for superoxide dismutase; superoxide dismutase copper chaperone; MGC138260; |
Gene ID | 9973 |
mRNA Refseq | NM_005125 |
Protein Refseq | NP_005116 |
MIM | 603864 |
UniProt ID | O14618 |
◆ Recombinant Proteins | ||
CCS-483H | Recombinant Human CCS Protein, with Cu (I) | +Inquiry |
CCS-3038HF | Recombinant Full Length Human CCS Protein, GST-tagged | +Inquiry |
CCS-10894H | Recombinant Human CCS, GST-tagged | +Inquiry |
CCS-8011Z | Recombinant Zebrafish CCS | +Inquiry |
CCS-1230R | Recombinant Rat CCS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCS-312HCL | Recombinant Human CCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCS Products
Required fields are marked with *
My Review for All CCS Products
Required fields are marked with *