Recombinant Full Length Human CCS Protein, GST-tagged

Cat.No. : CCS-3038HF
Product Overview : Human CCS full-length ORF (NP_005116.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 274 amino acids
Description : Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008]
Molecular Mass : 55.4 kDa
AA Sequence : MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCS copper chaperone for superoxide dismutase [ Homo sapiens ]
Official Symbol CCS
Synonyms CCS; copper chaperone for superoxide dismutase; superoxide dismutase copper chaperone; MGC138260;
Gene ID 9973
mRNA Refseq NM_005125
Protein Refseq NP_005116
MIM 603864
UniProt ID O14618

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCS Products

Required fields are marked with *

My Review for All CCS Products

Required fields are marked with *

0
cart-icon
0
compare icon