Recombinant Full Length Human CCS Protein, GST-tagged
Cat.No. : | CCS-3038HF |
Product Overview : | Human CCS full-length ORF (NP_005116.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 274 amino acids |
Description : | Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 55.4 kDa |
AA Sequence : | MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCS copper chaperone for superoxide dismutase [ Homo sapiens ] |
Official Symbol | CCS |
Synonyms | CCS; copper chaperone for superoxide dismutase; superoxide dismutase copper chaperone; MGC138260; |
Gene ID | 9973 |
mRNA Refseq | NM_005125 |
Protein Refseq | NP_005116 |
MIM | 603864 |
UniProt ID | O14618 |
◆ Recombinant Proteins | ||
CCS-483H | Recombinant Human CCS Protein, with Cu (I) | +Inquiry |
Ccs-2632R | Recombinant Rat Ccs protein, His & T7-tagged | +Inquiry |
CCS-1053H | Recombinant Human CCS protein, His-tagged | +Inquiry |
CCS-315H | Recombinant Human CCS protein, His-T7-tagged | +Inquiry |
Ccs-168M | Recombinant Mouse Ccs protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCS-312HCL | Recombinant Human CCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCS Products
Required fields are marked with *
My Review for All CCS Products
Required fields are marked with *
0
Inquiry Basket