Recombinant Human CD22, StrepII-tagged
Cat.No. : | CD22-246H |
Product Overview : | Purified, full-length human recombinant CD22 or B-cell receptor protein (amino acids 20-847, 828 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 75.1 kDa. (Accession NP_001762.2; UniProt P20273) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 20-847, 828 a.a. |
Description : | This product is the extracellular domain of the CD22. CD22 mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVH LNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSH HGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVS NDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGA ELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDV RVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVME GKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | CD22 CD22 molecule [ Homo sapiens ] |
Official Symbol | CD22 |
Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
Gene ID | 933 |
mRNA Refseq | NM_001185099 |
Protein Refseq | NP_001172028 |
MIM | 107266 |
UniProt ID | P20273 |
Chromosome Location | 19q13.1 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; |
Function | protein binding; sugar binding; |
◆ Recombinant Proteins | ||
Cd22-8321M | Recombinant Mouse Cd22 protein, hFc-tagged | +Inquiry |
CD22-1212R | Recombinant Rhesus macaque CD22 protein, His-tagged | +Inquiry |
Cd22-831M | Recombinant Mouse Cd22 Protein, MYC/DDK-tagged | +Inquiry |
CD22-333H | Active Recombinant Human CD22 Protein, LIgG2b Fc-tagged, low endotoxin | +Inquiry |
CD22-3947HAF488 | Active Recombinant Human CD22 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *
0
Inquiry Basket