Recombinant Human CD5

Cat.No. : CD5-26633TH
Product Overview : Recombinant full length Human CD5 with N terminal proprietary tag; predicted MWt: 80.96 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CD5 is a cluster of differentiation found on a subset of IgM-secreting B cells called B-1 cells, and also on T cells.
Protein length : 495 amino acids
Molecular Weight : 80.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRS NSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKV CQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQ LVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFL CNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQ CGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPL AYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH AENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPD NSSDSDYDLHGAQRL
Tag : Non
Gene Name : CD5 CD5 molecule [ Homo sapiens ]
Official Symbol : CD5
Synonyms : CD5; CD5 molecule; CD5 antigen (p56 62) , LEU1; T-cell surface glycoprotein CD5; T1;
Gene ID : 921
mRNA Refseq : NM_014207
Protein Refseq : NP_055022
MIM : 153340
Uniprot ID : P06127
Chromosome Location : 11q13
Pathway : B Cell Receptor Signaling Pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem;
Function : glycoprotein binding; protein binding; receptor activity; scavenger receptor activity; transmembrane signaling receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
08/18/2022

    The stability of CD5 is very good, and even if it is stored for a long time, it will not affect its performance.

    12/20/2021

      I have recommended it to other students, the price is affordable, the operation is convenient, and the effect is good.

      11/28/2020

        I'm very happy with the results, the stability is strong.

        Q&As (6)

        Ask a question
        What is the interaction between CD5 and other biomolecules? 05/11/2023

        There are interactions between CD5 and other biomolecules. For example, it binds to antigens and antibodies and participates in the activation and differentiation of immune cells, and also binds to other signal transduction molecules and participates in cell signal transduction.

        Which biomolecules can be used as molecular markers for CD5? 02/21/2022

        Certain biomolecules can be used as molecular markers of CD5, including CD5 antigens detected on the surface of lymphocytes, as well as related proteins and genes that interact with CD5. These markers can be used for early diagnosis of diseases, prognosis judgment, or monitoring the effectiveness of treatment.

        How can the efficacy and safety of treatments for CD5 be assessed? 09/12/2021

        Assessing the efficacy and safety of treatments targeting CD5 requires clinical trials and drug monitoring. The effectiveness of the treatment was evaluated by designing a rigorous clinical trial protocol that compared the disease remission rate, symptom improvement, and quality of life improvement between the treatment and control groups. At the same time, drug monitoring is used to monitor the safety and efficacy of drugs in actual use, adjust treatment regimens in a timely manner, maximize the efficacy of drugs and reduce the risk of side effects.

        What is the structure of CD5? 07/14/2021

        CD5 has a typical immunoglobulin superfamily domain, which is a single-stranded transmembrane glycoprotein that is distributed in an asymmetrical manner across the cell membrane. This structure allows it to bind to antigens and antibodies and participate in the immune response.

        What diseases are CD5 associated with? 11/19/2020

        CD5 has been linked to a number of immune system-related diseases. For example, certain autoimmune diseases, allergic reactions, transplant rejection, etc. In addition, CD5 has been implicated in the development and progression of certain tumors.

        How is the therapeutic strategy of CD5 evaluated? 11/06/2020

        Treatment strategies for CD5 include inhibition of its activity, regulation of its expression, and gene therapy. For example, the development of antibody drugs or small molecule inhibitors against CD5 to inhibit its overactivation in the immune response, or the regulation of CD5 expression through gene knockout or overexpression techniques.

        Ask a Question for All CD5 Products

        Required fields are marked with *

        My Review for All CD5 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends