Recombinant Full Length Human CD5 Protein, GST-tagged
Cat.No. : | CD5-2999HF |
Product Overview : | Human CD5 full-length ORF (ABM83003.1, 1 a.a. - 495 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 495 amino acids |
Description : | This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 80.96 kDa |
AA Sequence : | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD5 CD5 molecule [ Homo sapiens ] |
Official Symbol | CD5 |
Synonyms | CD5; CD5 molecule; CD5 antigen (p56 62), LEU1; T-cell surface glycoprotein CD5; T1; CD5 antigen (p56-62); lymphocyte antigen T1/Leu-1; LEU1; |
Gene ID | 921 |
mRNA Refseq | NM_014207 |
Protein Refseq | NP_055022 |
MIM | 153340 |
UniProt ID | P06127 |
◆ Recombinant Proteins | ||
CD5-175H | Recombinant Human CD5 protein, His-tagged | +Inquiry |
CD5-135H | Recombinant Human CD5 protein, His-tagged | +Inquiry |
RFL14307BF | Recombinant Full Length Bovine T-Cell Surface Glycoprotein Cd5(Cd5) Protein, His-Tagged | +Inquiry |
CD5-5297H | Recombinant Human CD5 Protein (Met1-Pro371), C-His tagged | +Inquiry |
CD5-2999HF | Recombinant Full Length Human CD5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD5-2498MCL | Recombinant Mouse CD5 cell lysate | +Inquiry |
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
CD5-1293RCL | Recombinant Rat CD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD5 Products
Required fields are marked with *
My Review for All CD5 Products
Required fields are marked with *