Recombinant Human CD72 Protein, Fc-tagged
Cat.No. : | CD72-169H |
Product Overview : | Recombinant human CD72 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 359 |
Description : | Predicted to enable signaling receptor binding activity. Predicted to be involved in cell adhesion. Is integral component of plasma membrane. |
Form : | Lyophilized |
Molecular Mass : | 54 kDa |
AA Sequence : | MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD72 CD72 molecule [ Homo sapiens (human) ] |
Official Symbol | CD72 |
Synonyms | CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2; |
Gene ID | 971 |
mRNA Refseq | NM_001782 |
Protein Refseq | NP_001773 |
MIM | 107272 |
UniProt ID | P21854 |
◆ Recombinant Proteins | ||
CD72-270HA | Recombinant Human CD72 protein, Fc-tagged, APC labeled | +Inquiry |
CD72-151H | Recombinant Human CD72 Protein, DYKDDDDK-tagged | +Inquiry |
CD72-3094C | Recombinant Chicken CD72 | +Inquiry |
CD72-2994H | Recombinant Human CD72 protein, Fc-tagged | +Inquiry |
CD72-3056HF | Recombinant Full Length Human CD72 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD72-7674HCL | Recombinant Human CD72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD72 Products
Required fields are marked with *
My Review for All CD72 Products
Required fields are marked with *
0
Inquiry Basket