Recombinant Full Length Human CD72 Protein, GST-tagged

Cat.No. : CD72-3056HF
Product Overview : Human CD72 full-length ORF (AAH30227.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 359 amino acids
Description : CD72 (CD72 Molecule) is a Protein Coding gene. Diseases associated with CD72 include Small Intestine Lymphoma and Chronic Lymphocytic Leukemia. Among its related pathways are Natural Killer Cell Receptors: Human Target Cell – NK Cell Ligand-Receptor Interactions and Developmental Biology. GO annotations related to this gene include receptor binding and carbohydrate binding.
Molecular Mass : 65.89 kDa
AA Sequence : MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD72 CD72 molecule [ Homo sapiens ]
Official Symbol CD72
Synonyms CD72; CD72 molecule; CD72 antigen; B-cell differentiation antigen CD72; CD72b; LYB2; lyb-2;
Gene ID 971
mRNA Refseq NM_001782
Protein Refseq NP_001773
MIM 107272
UniProt ID P21854

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD72 Products

Required fields are marked with *

My Review for All CD72 Products

Required fields are marked with *

0
cart-icon
0
compare icon