Recombinant Human CD8A Protein, C-His-tagged
Cat.No. : | CD8A-176H |
Product Overview : | Recombinant Human CD8A Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Cluster of Differentiation 8 (CD8) is a disulphide-linked heterodimer consisting of the unrelated α and β subunits. Each subunit is a glycoprotein composed of a single extracellular Ig-like domain, a polypeptide linker, a transmembrane part and a short cytoplasmic tail. On T cells, CD8 is the coreceptor for the T cell receptor (TCR), and these two distinct structures recognize the Antigen–Major Histocompatibility Complex (MHC). Specifically, the Ig-like domain of CD8α interacts with the α3-domain of the MHC class I molecule. CD8 ensures specificity of the TCR–antigen interaction, prolongs the contact between the T cell and the antigen presenting cell, and the α chain recruits the tyrosine kinase Lck, which is essential for T cell activation. |
Molecular Mass : | ~18 kDa |
AA Sequence : | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD8A CD8a molecule [ Homo sapiens (human) ] |
Official Symbol | CD8A |
Synonyms | CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2; |
Gene ID | 925 |
mRNA Refseq | NM_001145873 |
Protein Refseq | NP_001139345 |
MIM | 186910 |
UniProt ID | P01732 |
◆ Recombinant Proteins | ||
CD8A-3508C | Recombinant Chicken CD8A | +Inquiry |
CD8A-6744H | Recombinant Human CD8A protein, His-Avi-tagged, Biotinylated | +Inquiry |
CD8A-1021F | Recombinant Ferret CD8A protein(Met1-Glu186), His-tagged | +Inquiry |
CD8A-5375B | Recombinant Bovine CD8A protein, His-tagged | +Inquiry |
CD8A--1097H | Recombinant Human CD8A Protein (Met1-Asp182), HlgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *
0
Inquiry Basket