Recombinant Bovine CD8A Protein (26-189 aa), His-SUMO-tagged
| Cat.No. : | CD8A-401B |
| Product Overview : | Recombinant Bovine CD8A Protein (26-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 26-189 aa |
| Description : | Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 33.9 kDa |
| AA Sequence : | LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | CD8A CD8a molecule [ Bos taurus (cattle) ] |
| Official Symbol | CD8A |
| Gene ID | 281060 |
| mRNA Refseq | NM_174015 |
| Protein Refseq | NP_776440 |
| UniProt ID | P31783 |
| ◆ Recombinant Proteins | ||
| CD8A-133H | Recombinant Human CD8A Protein, His-tagged | +Inquiry |
| CD8A-27890TH | Recombinant Human CD8A | +Inquiry |
| CD8A-3719Z | Recombinant Zebrafish CD8A | +Inquiry |
| CD8A-1974R | Recombinant Rat CD8A protein, hFc-tagged | +Inquiry |
| CD8A-0878H | Recombinant Human CD8A Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
| CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
| CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
| CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD8A Products
Required fields are marked with *
My Review for All CD8A Products
Required fields are marked with *
