Recombinant Human CDX2
Cat.No. : | CDX2-27917TH |
Product Overview : | Recombinant full length Human CDX2 with N terminal proprietary tag, 60.54kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 313 amino acids |
Description : | The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al. |
Molecular Weight : | 60.540kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDY GGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGY APGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPH HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGG QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE PLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
Sequence Similarities : | Belongs to the Caudal homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
Official Symbol | CDX2 |
Synonyms | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2 , CDX3; homeobox protein CDX-2; |
Gene ID | 1045 |
mRNA Refseq | NM_001265 |
Protein Refseq | NP_001256 |
MIM | 600297 |
Uniprot ID | Q99626 |
Chromosome Location | 13q12.2 |
Pathway | Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem; |
Function | sequence-specific DNA binding transcription factor activity; transcription corepressor activity; transcription regulatory region sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
CDX2-1835H | Recombinant Human CDX2 protein, GST-tagged | +Inquiry |
CDX2-75HF | Recombinant Full Length Human CDX2 Protein | +Inquiry |
CDX2-600H | Recombinant Human CDX2 Protein, His/GST-tagged | +Inquiry |
CDX2-1552M | Recombinant Mouse CDX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDX2-11075H | Recombinant Human CDX2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDX2-7602HCL | Recombinant Human CDX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDX2 Products
Required fields are marked with *
My Review for All CDX2 Products
Required fields are marked with *
0
Inquiry Basket