Recombinant Full Length Human CDX2 Protein
| Cat.No. : | CDX2-75HF |
| Product Overview : | Recombinant full length Human CDX2 with N terminal proprietary tag, 60.54kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 313 amino acids |
| Description : | The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al. |
| Form : | Liquid |
| Molecular Mass : | 60.540kDa inclusive of tags |
| AA Sequence : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDY GGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGY APGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPH HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGG QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE PLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
| Official Symbol | CDX2 |
| Synonyms | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2 , CDX3; homeobox protein CDX-2 |
| Gene ID | 1045 |
| mRNA Refseq | NM_001265 |
| Protein Refseq | NP_001256 |
| MIM | 600297 |
| UniProt ID | Q99626 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDX2 Products
Required fields are marked with *
My Review for All CDX2 Products
Required fields are marked with *




