Recombinant Full Length Human CDX2 Protein
Cat.No. : | CDX2-75HF |
Product Overview : | Recombinant full length Human CDX2 with N terminal proprietary tag, 60.54kDa. |
- Specification
- Gene Information
- Related Products
Description : | The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 60.540kDa inclusive of tags |
Protein Length : | 313 amino acids |
AA Sequence : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDY GGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGY APGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPH HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGG QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE PLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
Official Symbol : | CDX2 |
Synonyms : | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2 , CDX3; homeobox protein CDX-2 |
Gene ID : | 1045 |
mRNA Refseq : | NM_001265 |
Protein Refseq : | NP_001256 |
MIM : | 600297 |
UniProt ID : | Q99626 |
Products Types
◆ Recombinant Protein | ||
CDX2-1083H | Recombinant Human CDX2 Protein, GST-Tagged | +Inquiry |
CDX2-1552M | Recombinant Mouse CDX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDX2-600H | Recombinant Human CDX2 Protein, His/GST-tagged | +Inquiry |
CDX2-1186H | Recombinant Human CDX2 Protein (Met1-Gln313), N-GST tagged | +Inquiry |
CDX2-3242M | Recombinant Mouse CDX2 Protein | +Inquiry |
◆ Lysates | ||
CDX2-7602HCL | Recombinant Human CDX2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket