Recombinant Full Length Human CDX2 Protein
Cat.No. : | CDX2-75HF |
Product Overview : | Recombinant full length Human CDX2 with N terminal proprietary tag, 60.54kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 313 amino acids |
Description : | The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al. |
Form : | Liquid |
Molecular Mass : | 60.540kDa inclusive of tags |
AA Sequence : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDY GGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGY APGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPH HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGG QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE PLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
Official Symbol | CDX2 |
Synonyms | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2 , CDX3; homeobox protein CDX-2 |
Gene ID | 1045 |
mRNA Refseq | NM_001265 |
Protein Refseq | NP_001256 |
MIM | 600297 |
UniProt ID | Q99626 |
◆ Recombinant Proteins | ||
CDX2-27917TH | Recombinant Human CDX2 | +Inquiry |
CDX2-1083H | Recombinant Human CDX2 Protein, GST-Tagged | +Inquiry |
CDX2-5884C | Recombinant Chicken CDX2 | +Inquiry |
CDX2-75HF | Recombinant Full Length Human CDX2 Protein | +Inquiry |
CDX2-3265HF | Recombinant Full Length Human CDX2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDX2-7602HCL | Recombinant Human CDX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDX2 Products
Required fields are marked with *
My Review for All CDX2 Products
Required fields are marked with *
0
Inquiry Basket