Recombinant Human CLCF1, His-tagged

Cat.No. : CLCF1-29299TH
Product Overview : Recombinant full length Human NNT1 with an N terminal His tag; 219aa, 24.6kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 198 amino acids
Description : This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Conjugation : HIS
Molecular Weight : 24.600kDa inclusive of tags
Tissue specificity : Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 3.50Constituents:10% Glycerol, 2.4% Urea, 0.59% Sodium citrate
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Sequence Similarities : Belongs to the IL-6 superfamily.
Gene Name CLCF1 cardiotrophin-like cytokine factor 1 [ Homo sapiens ]
Official Symbol CLCF1
Synonyms CLCF1; cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine like factor 1; B cell stimulating factor 3; BSF 3; BSF3; CISS2; CLC; cold induced sweating syndrome 2; NNT 1; NNT1; novel neurotrophin 1; NR6;
Gene ID 23529
mRNA Refseq NM_001166212
Protein Refseq NP_001159684
MIM 607672
Uniprot ID Q9UBD9
Chromosome Location 11q13.3
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function ciliary neurotrophic factor receptor binding; contributes_to ciliary neurotrophic factor receptor binding; contributes_to cytokine activity; cytokine activity; growth factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLCF1 Products

Required fields are marked with *

My Review for All CLCF1 Products

Required fields are marked with *

0
cart-icon