Recombinant Human CLCF1, His-tagged
Cat.No. : | CLCF1-29299TH |
Product Overview : | Recombinant full length Human NNT1 with an N terminal His tag; 219aa, 24.6kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 198 amino acids |
Description : | This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Conjugation : | HIS |
Molecular Weight : | 24.600kDa inclusive of tags |
Tissue specificity : | Expressed predominantly in lymph nodes, spleen, peripheral blood lymphocytes, bone marrow, and fetal liver. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 3.50Constituents:10% Glycerol, 2.4% Urea, 0.59% Sodium citrate |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF |
Sequence Similarities : | Belongs to the IL-6 superfamily. |
Gene Name | CLCF1 cardiotrophin-like cytokine factor 1 [ Homo sapiens ] |
Official Symbol | CLCF1 |
Synonyms | CLCF1; cardiotrophin-like cytokine factor 1; CRLF1 associated cytokine like factor 1; B cell stimulating factor 3; BSF 3; BSF3; CISS2; CLC; cold induced sweating syndrome 2; NNT 1; NNT1; novel neurotrophin 1; NR6; |
Gene ID | 23529 |
mRNA Refseq | NM_001166212 |
Protein Refseq | NP_001159684 |
MIM | 607672 |
Uniprot ID | Q9UBD9 |
Chromosome Location | 11q13.3 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | ciliary neurotrophic factor receptor binding; contributes_to ciliary neurotrophic factor receptor binding; contributes_to cytokine activity; cytokine activity; growth factor activity; |
◆ Recombinant Proteins | ||
CLCF1-1413H | Recombinant Human CLCF1 Protein, GST-tagged | +Inquiry |
CLCF1-3242H | Recombinant Human CLCF1 Protein, MYC/DDK-tagged | +Inquiry |
CLCF1-1716M | Recombinant Mouse CLCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Clcf1-2178M | Recombinant Mouse Clcf1 Protein, Myc/DDK-tagged | +Inquiry |
CLCF1-29299TH | Recombinant Human CLCF1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLCF1-001HCL | Recombinant Human CLCF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLCF1 Products
Required fields are marked with *
My Review for All CLCF1 Products
Required fields are marked with *