Recombinant Human CLDN3

Cat.No. : CLDN3-27271TH
Product Overview : Recombinant full length Human Claudin 3 with an N terminal proprietary tag; Predicted MWt 50.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 220 amino acids
Description : Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat.
Molecular Weight : 50.310kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNII TSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR ALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMG AGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSA PRSTGPGASLGTGYDRKDYV
Sequence Similarities : Belongs to the claudin family.
Gene Name CLDN3 claudin 3 [ Homo sapiens ]
Official Symbol CLDN3
Synonyms CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein;
Gene ID 1365
mRNA Refseq NM_001306
Protein Refseq NP_001297
MIM 602910
Uniprot ID O15551
Chromosome Location 7q11
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function identical protein binding; structural molecule activity; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN3 Products

Required fields are marked with *

My Review for All CLDN3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon