Recombinant Human CLDN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CLDN4-4751H
Product Overview : CLDN4 MS Standard C13 and N15-labeled recombinant protein (NP_001296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems.
Molecular Mass : 22.1 kDa
AA Sequence : MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CLDN4 claudin 4 [ Homo sapiens (human) ]
Official Symbol CLDN4
Synonyms CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R;
Gene ID 1364
mRNA Refseq NM_001305
Protein Refseq NP_001296
MIM 602909
UniProt ID O14493

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN4 Products

Required fields are marked with *

My Review for All CLDN4 Products

Required fields are marked with *

0
cart-icon