Recombinant Human CLDN4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CLDN4-4751H |
Product Overview : | CLDN4 MS Standard C13 and N15-labeled recombinant protein (NP_001296) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CLDN4 claudin 4 [ Homo sapiens (human) ] |
Official Symbol | CLDN4 |
Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R; |
Gene ID | 1364 |
mRNA Refseq | NM_001305 |
Protein Refseq | NP_001296 |
MIM | 602909 |
UniProt ID | O14493 |
◆ Recombinant Proteins | ||
CLDN4-0392H | Active Recombinant Human CLDN4 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CLDN4-257H | Active Recombinant Human CLDN4 Full Length Transmembrane protein, His&Strep-tagged(Nanodisc) | +Inquiry |
CLDN4-26708TH | Recombinant Human CLDN4 | +Inquiry |
Cldn4-901M | Recombinant Mouse Cldn4 Protein, MYC/DDK-tagged | +Inquiry |
RFL28924CF | Recombinant Full Length Chlorocebus Aethiops Claudin-4(Cldn4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
0
Inquiry Basket