Recombinant Full Length Human CLDN4 Protein, C-Flag-tagged
Cat.No. : | CLDN4-574HFL |
Product Overview : | Recombinant Full Length Human CLDN4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Full Length : | Full L. |
Gene Name | CLDN4 claudin 4 [ Homo sapiens (human) ] |
Official Symbol | CLDN4 |
Synonyms | CPER; CPE-R; CPETR; CPETR1; WBSCR8; hCPE-R |
Gene ID | 1364 |
mRNA Refseq | NM_001305.5 |
Protein Refseq | NP_001296.1 |
MIM | 602909 |
UniProt ID | O14493 |
◆ Recombinant Proteins | ||
CLDN4-257H | Active Recombinant Human CLDN4 Full Length Transmembrane protein, His&Strep-tagged(Nanodisc) | +Inquiry |
CLDN4-0333H | Recombinant Human CLDN4 Protein (Met1-Val209), C-His-tagged | +Inquiry |
CLDN4-4751H | Recombinant Human CLDN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLDN4-3538M | Recombinant Mouse CLDN4 Protein | +Inquiry |
CLDN4-1733M | Recombinant Mouse CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *
0
Inquiry Basket