Recombinant Human CLIC2, His-tagged

Cat.No. : CLIC2-27815TH
Product Overview : Recombinant full length Human CLIC2 with an N terminal His tag; 267 amino acids with tag, Predicted MWt 30.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 247 amino acids
Description : Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue.This gene maps to the candidate region on chromosome X for incontinentia pigmenti.
Conjugation : HIS
Molecular Weight : 30.500kDa inclusive of tags
Tissue specificity : Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
Sequence Similarities : Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain.
Gene Name CLIC2 chloride intracellular channel 2 [ Homo sapiens ]
Official Symbol CLIC2
Synonyms CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121;
Gene ID 1193
mRNA Refseq NM_001289
Protein Refseq NP_001280
MIM 300138
Uniprot ID O15247
Chromosome Location Xq28
Function chloride channel activity; voltage-gated chloride channel activity; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLIC2 Products

Required fields are marked with *

My Review for All CLIC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon