Recombinant Human CLIC2 Protein, GST-tagged
Cat.No. : | CLIC2-1478H |
Product Overview : | Human CLIC2 full-length ORF ( AAH22305, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017] |
Molecular Mass : | 52.91 kDa |
AA Sequence : | MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNITKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLIC2 chloride intracellular channel 2 [ Homo sapiens ] |
Official Symbol | CLIC2 |
Synonyms | CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121; CLIC2b; |
Gene ID | 1193 |
mRNA Refseq | NM_001289 |
Protein Refseq | NP_001280 |
MIM | 300138 |
UniProt ID | O15247 |
◆ Recombinant Proteins | ||
CLIC2-3512H | Recombinant Human Chloride Intracellular Channel 2, His-tagged | +Inquiry |
CLIC2-2786C | Recombinant Chicken CLIC2 | +Inquiry |
CLIC2-27817TH | Recombinant Human CLIC2 | +Inquiry |
RFL35635HF | Recombinant Full Length Human Chloride Intracellular Channel Protein 2(Clic2) Protein, His-Tagged | +Inquiry |
CLIC2-1449R | Recombinant Rat CLIC2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC2-7447HCL | Recombinant Human CLIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC2 Products
Required fields are marked with *
My Review for All CLIC2 Products
Required fields are marked with *