Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
158 |
Description : |
Macrophage Colony Stimulating Factor (M-CSF), also named CSF-1, is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. It is produced by osteoblasts (as a result of endocrine stimulation by parathyroid hormone) exerts paracrine effects on osteoclasts and can interact with CSF1R. M-CSF is a four α-helical bundle cytokine and its active form is found extracellularly as a disulfide-linked homodimer. Four transcript variants encoding three different isoforms have been reported for M-CSF gene. Although forms may vary, all of them contain the N-terminal 150 a.a. portion that is necessary and sufficient for interaction with the receptor. The first 223 a.a. of mature human M-CSF shares 88 %, 86 %, 81 % and 74 % sequence identity with corresponding regions of dog, cow, mouse and rat M-CSF, respectively. Human M-CSF is active in the mouse, but mouse M-CSF is reported to be species-specific. |
Form : |
Lyophilized from a 0.2μm filtered solution in PBS, pH7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine M-NFS-60 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : |
Approximately 36.8 kDa, a disulfide-linked homodimer consisting of two 158 amino acid polypeptide chains. |
AA Sequence : |
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS |
Endotoxin : |
Less than 1 EU/μg of rHuM-CSF as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |