Recombinant Human CTNND1 Protein, GST-tagged
Cat.No. : | CTNND1-2088H |
Product Overview : | Human CTNND1 partial ORF ( AAH10501, 721 a.a. - 830 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTNND1 catenin (cadherin-associated protein), delta 1 [ Homo sapiens ] |
Official Symbol | CTNND1 |
Synonyms | CTNND1; catenin (cadherin-associated protein), delta 1; CTNND; catenin delta-1; KIAA0384; p120; p120cas; p120ctn; p120 catenin; cadherin-associated Src substrate; CAS; P120CAS; P120CTN; p120(CAS); p120(CTN); |
Gene ID | 1500 |
mRNA Refseq | NM_001085458 |
Protein Refseq | NP_001078927 |
MIM | 601045 |
UniProt ID | O60716 |
◆ Recombinant Proteins | ||
CTNND1-12H | Recombinant Human CTNND1 Protein, N-His6ABP-tagged | +Inquiry |
CTNND1-2088H | Recombinant Human CTNND1 Protein, GST-tagged | +Inquiry |
CTNND1-1083R | Recombinant Rhesus monkey CTNND1 Protein, His-tagged | +Inquiry |
CTNND1-3373H | Recombinant Human CTNND1 Protein, MYC/DDK-tagged | +Inquiry |
CTNND1-1289H | Recombinant Human CTNND1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTNND1-419HCL | Recombinant Human CTNND1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNND1 Products
Required fields are marked with *
My Review for All CTNND1 Products
Required fields are marked with *