Recombinant Human CTNND1 Protein, GST-tagged

Cat.No. : CTNND1-2088H
Product Overview : Human CTNND1 partial ORF ( AAH10501, 721 a.a. - 830 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. [provided by RefSeq, Dec 2010]
Molecular Mass : 37.84 kDa
AA Sequence : WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTNND1 catenin (cadherin-associated protein), delta 1 [ Homo sapiens ]
Official Symbol CTNND1
Synonyms CTNND1; catenin (cadherin-associated protein), delta 1; CTNND; catenin delta-1; KIAA0384; p120; p120cas; p120ctn; p120 catenin; cadherin-associated Src substrate; CAS; P120CAS; P120CTN; p120(CAS); p120(CTN);
Gene ID 1500
mRNA Refseq NM_001085458
Protein Refseq NP_001078927
MIM 601045
UniProt ID O60716

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNND1 Products

Required fields are marked with *

My Review for All CTNND1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon