Recombinant Human CTNND1 Protein, N-His6ABP-tagged

Cat.No. : CTNND1-12H
Product Overview : Recombinant protein fragment of Human CTNND1 with a N-terminal His6ABP tag (ABP=Albumin Binding Protein derived from Streptococcal Protein G) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : ABP&His
Description : This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.
Molecular Mass : 33 kDa including tags
AA Sequence : ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH
Purity : >80% by SDS-PAGE and Coomassie blue staining
Applications : Blocking agent and positive assay control using corresponding antibodies.
Usage : Suitable as control in WB and preadsorption assays using indicated corresponding antibodies.
Storage : Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS and 1M Urea, pH 7.4.
Shipping : Shipped in liquid form on wet ice.
Gene Name CTNND1 catenin delta 1 [ Homo sapiens (human) ]
Official Symbol CTNND1 catenin delta 1 [ Homo sapiens (human) ]
Synonyms CTNND1; catenin delta 1; CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN); catenin delta-1; cadherin-associated Src substrate; catenin (cadherin-associated protein), delta 1; p120 catenin
Gene ID 1500
mRNA Refseq NM_001331
Protein Refseq NP_001322
MIM 601045
UniProt ID O60716

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNND1 Products

Required fields are marked with *

My Review for All CTNND1 Products

Required fields are marked with *

0
cart-icon
0
compare icon