Recombinant Human CTNND1 Protein, N-His6ABP-tagged
Cat.No. : | CTNND1-12H |
Product Overview : | Recombinant protein fragment of Human CTNND1 with a N-terminal His6ABP tag (ABP=Albumin Binding Protein derived from Streptococcal Protein G) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | ABP&His |
Description : | This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. |
Molecular Mass : | 33 kDa including tags |
AA Sequence : | ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH |
Purity : | >80% by SDS-PAGE and Coomassie blue staining |
Applications : | Blocking agent and positive assay control using corresponding antibodies. |
Usage : | Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. |
Storage : | Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS and 1M Urea, pH 7.4. |
Shipping : | Shipped in liquid form on wet ice. |
Gene Name | CTNND1 catenin delta 1 [ Homo sapiens (human) ] |
Official Symbol | CTNND1 catenin delta 1 [ Homo sapiens (human) ] |
Synonyms | CTNND1; catenin delta 1; CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN); catenin delta-1; cadherin-associated Src substrate; catenin (cadherin-associated protein), delta 1; p120 catenin |
Gene ID | 1500 |
mRNA Refseq | NM_001331 |
Protein Refseq | NP_001322 |
MIM | 601045 |
UniProt ID | O60716 |
◆ Recombinant Proteins | ||
CTNND1-2058M | Recombinant Mouse CTNND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNND1-12H | Recombinant Human CTNND1 Protein, N-His6ABP-tagged | +Inquiry |
CTNND1-740HFL | Recombinant Full Length Human CTNND1 Protein, C-Flag-tagged | +Inquiry |
CTNND1-1289H | Recombinant Human CTNND1 Protein, His-tagged | +Inquiry |
CTNND1-4035M | Recombinant Mouse CTNND1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTNND1-419HCL | Recombinant Human CTNND1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNND1 Products
Required fields are marked with *
My Review for All CTNND1 Products
Required fields are marked with *