Recombinant Human CXXC4 protein, His-tagged

Cat.No. : CXXC4-432H
Product Overview : Recombinant Human CXXC4 protein(1-115 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-115 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNH
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name CXXC4 CXXC finger protein 4 [ Homo sapiens ]
Official Symbol CXXC4
Synonyms CXXC4; CXXC finger protein 4; CXXC-type zinc finger protein 4; Dvl binding protein IDAX (inhibition of the Dvl and Axin complex); IDAX; CXXC finger 4; inhibition of the Dvl and axin complex protein; Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex); MGC149872;
Gene ID 80319
mRNA Refseq NM_025212
Protein Refseq NP_079488
MIM 611645
UniProt ID Q9H2H0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXXC4 Products

Required fields are marked with *

My Review for All CXXC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon