Recombinant Human CXXC4 protein, His-tagged
| Cat.No. : | CXXC4-432H |
| Product Overview : | Recombinant Human CXXC4 protein(1-115 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-115 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNH |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CXXC4 CXXC finger protein 4 [ Homo sapiens ] |
| Official Symbol | CXXC4 |
| Synonyms | CXXC4; CXXC finger protein 4; CXXC-type zinc finger protein 4; Dvl binding protein IDAX (inhibition of the Dvl and Axin complex); IDAX; CXXC finger 4; inhibition of the Dvl and axin complex protein; Dvl-binding protein IDAX (inhibition of the Dvl and Axin complex); MGC149872; |
| Gene ID | 80319 |
| mRNA Refseq | NM_025212 |
| Protein Refseq | NP_079488 |
| MIM | 611645 |
| UniProt ID | Q9H2H0 |
| ◆ Recombinant Proteins | ||
| CXXC4-11741H | Recombinant Human CXXC4, GST-tagged | +Inquiry |
| CXXC4-432H | Recombinant Human CXXC4 protein, His-tagged | +Inquiry |
| CXXC4-2105M | Recombinant Mouse CXXC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CXXC4-2373HF | Recombinant Full Length Human CXXC4 Protein, GST-tagged | +Inquiry |
| CXXC4-4117M | Recombinant Mouse CXXC4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXXC4-7150HCL | Recombinant Human CXXC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXXC4 Products
Required fields are marked with *
My Review for All CXXC4 Products
Required fields are marked with *
